下载GeneBank文件(.gb)

LOCUS       pHR-scFv-GCN4-sf       10059 bp DNA     circular SYN 13-MAY-2021
DEFINITION  The plasmid encodes an antibody that binds to the GCN4 peptide from 
            the SunTag system, and is fused to sfGFP for imaging.
ACCESSION   .
VERSION     .
KEYWORDS    pHR-scFv-GCN4-sfGFP-GB1-dWPRE.
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10059)
  AUTHORS   Tanenbaum ME, Gilbert LA, Qi LS, Weissman JS, Vale RD
  TITLE     A Protein-Tagging System for Signal Amplification in Gene Expression
            and Fluorescence Imaging.
  JOURNAL   Cell. 2014 Oct 8. pii: S0092-8674(14)01227-6. doi: 
            10.1016/j.cell.2014.09.039.
  PUBMED    25307933
REFERENCE   2  (bases 1 to 10059)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 10059)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Cell. 2014 
            Oct 8. pii: S0092-8674(14)01227-6. doi: 10.1016/j.cell.2014.09.039."
COMMENT     SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10059
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        complement(16..34)
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     primer_bind     complement(324..343)
                     /label=pBRrevBam
                     /note="pBR322 vectors, tet region, downstream of BamHI,
                     reverse primer"
     primer_bind     complement(557..576)
                     /label=pRS-marker
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"
     primer_bind     676..698
                     /label=pGEX 3'
                     /note="pGEX vectors, reverse primer"
     primer_bind     complement(736..754)
                     /label=pBRforEco
                     /note="pBR322 vectors, upsteam of EcoRI site, forward
                     primer"
     promoter        822..926
                     /label=AmpR promoter
     CDS             927..1784
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      1958..2546
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     2700..2717
                     /label=L4440
                     /note="L4440 vector, forward primer"
     promoter        2792..3121
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     intron          4255..4320
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             4450..4470
                     /label=SV40 NLS
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     polyA_signal    4895..5029
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     LTR             5197..5830
                     /label=3' LTR
                     /note="3' long terminal repeat (LTR) from HIV-1"
     misc_feature    5877..6002
                     /label=HIV-1 Psi
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    6499..6732
                     /label=RRE
                     /note="The Rev response element (RRE) of HIV-1 allows for 
                     Rev-dependent mRNA export from the nucleus to the 
                     cytoplasm."
     CDS             6917..6961
                     /label=gp41 peptide
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et 
                     al., 2013)"
     CDS             7110..7151
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
     misc_feature    7246..7363
                     /label=cPPT/CTS
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     promoter        7516..7923
                     /label=SFFV promoter
                     /note="spleen focus-forming virus long terminal repeat
                     (LTR) promoter"
     regulatory      7957..7966
                     /label=Kozak sequence
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             8704..8730
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             8821..9531
                     /label=superfolder GFP
                     /note="GFP variant that folds robustly even when fused to
                     poorly folded proteins (Nager et al., 2011)"
     CDS             9553..9714
                     /codon_start=1
                     /product="B1 domain of Streptococcal protein G   "
                     /label=GB1
                     /note="effective as a solubilizing fusion partner (Cheng
                     and Patel, 2004)"
                     /translation="YKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD
                     ATKTFTVTE"
     LTR             9817..10050
                     /label=3' LTR (Delta-U3)
                     /note="self-inactivating 3' long terminal repeat (LTR) from
                     HIV-1"