A two chain bacteriocin. Shown is the sequence for chain a. The peptide sequence for chain b is GFWGGLGYIAGRVGAAYGHAQASANNHHSPING. Lactocin 705 has Antimicrobial activity. The source of Lactocin 705 is Lactobacillus casei CRL 705. Lactocin 705 alpha peptide is Cat.#: 309482.
Cuozzo SA, Sesma F, Palacios JM, de Ruíz Holgado AP, Raya RR. Identification and nucleotide sequence of genes involved in the synthesis of lactocin 705, a two-peptide bacteriocin from Lactobacillus casei CRL 705. FEMS Microbiol Lett. 2000 Apr 15;185(2):157-61.